PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0039s0080.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family MYB
Protein Properties Length: 342aa    MW: 37660.5 Da    PI: 6.905
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0039s0080.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.81.3e-181461148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
         Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                            +g+WT+eEd++lv+ ++++G g+W++ ++  g++R++k+c++rw +yl
  SapurV1A.0039s0080.1.p 14 KGPWTPEEDQKLVKHIQKHGHGSWRALPKVAGLNRCGKSCRLRWTNYL 61
                            79********************************************97 PP

2Myb_DNA-binding551.8e-1767112148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
         Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                             rg++++eE++ +++++  lG++ W++Ia++++ gRt++++k++w+++l
  SapurV1A.0039s0080.1.p  67 RGKFSEEEEQTILNLHSVLGNK-WSAIASHLP-GRTDNEIKNFWNTHL 112
                             89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.9E-26564IPR009057Homeodomain-like
PROSITE profilePS5129417.755961IPR017930Myb domain
SuperFamilySSF466892.13E-3211108IPR009057Homeodomain-like
SMARTSM007175.2E-161363IPR001005SANT/Myb domain
PfamPF002492.2E-171461IPR001005SANT/Myb domain
CDDcd001673.85E-131661No hitNo description
PROSITE profilePS5129426.87862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.5E-2865117IPR009057Homeodomain-like
SMARTSM007175.9E-1766114IPR001005SANT/Myb domain
PfamPF002491.9E-1667112IPR001005SANT/Myb domain
CDDcd001677.40E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MGRSPCCDET GLKKGPWTPE EDQKLVKHIQ KHGHGSWRAL PKVAGLNRCG KSCRLRWTNY  60
LRPDIKRGKF SEEEEQTILN LHSVLGNKWS AIASHLPGRT DNEIKNFWNT HLKKKLIQMG  120
FDPMTHRPRT DIFSSLPNLI ALANLKELID HHSLEEHALR LQTEAAQMAK LQYLQYLFPP  180
QPPASSNIAT SSNQINNIGT FSDIEAFNLL NSLASLKDSP SVSSLSQLDL SASSLQGIND  240
SIPFSHLPDL QIPCNYQAPP TKGMVQASEF TVFSQGGNSP ISPFQFASSS TPFPPSVAPP  300
VTQISSMVNS LGDASSNSSY GEEAPSVWND LLEDPMFRDI A*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-32121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00503DAPTransfer from AT5G10280Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011022802.10.0PREDICTED: myb-related protein 308-like
TrEMBLB9HFF90.0B9HFF9_POPTR; Uncharacterized protein
STRINGPOPTR_0007s05360.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.11e-99myb domain protein 93